Lineage for d2icwe1 (2icw E:93-190)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784902Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 784910Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 784939Domain d2icwe1: 2icw E:93-190 [137249]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb2, d2icwd1, d2icwd2, d2icwe2, d2icwg1, d2icwh1, d2icwj1, d2icwl1
    automatically matched to d1d5xb1
    mutant

Details for d2icwe1

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (E:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2icwe1:

Sequence, based on SEQRES records: (download)

>d2icwe1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d2icwe1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqt
lvmletvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d2icwe1:

Click to download the PDB-style file with coordinates for d2icwe1.
(The format of our PDB-style files is described here.)

Timeline for d2icwe1: