Lineage for d2icwl1 (2icw L:3-113)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783727Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 783866Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries)
  8. 783884Domain d2icwl1: 2icw L:3-113 [145522]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwg1, d2icwh1
    automatically matched to 2ICW J:1-113
    mutant

Details for d2icwl1

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (L:) T-cell receptor beta chain V

SCOP Domain Sequences for d2icwl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwl1 b.1.1.1 (L:3-113) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdipd
gykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvlssa

SCOP Domain Coordinates for d2icwl1:

Click to download the PDB-style file with coordinates for d2icwl1.
(The format of our PDB-style files is described here.)

Timeline for d2icwl1: