Lineage for d2icwg1 (2icw G:1-213)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780064Fold a.202: Superantigen MAM [101343] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780065Superfamily a.202.1: Superantigen MAM [101344] (1 family) (S)
  5. 780066Family a.202.1.1: Superantigen MAM [101345] (1 protein)
  6. 780067Protein Superantigen MAM [101346] (1 species)
  7. 780068Species Mycoplasma arthritidis [TaxId:2111] [101347] (3 PDB entries)
  8. 780069Domain d2icwg1: 2icw G:1-213 [137251]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwj1, d2icwl1
    automatically matched to d1r5id_
    mutant

Details for d2icwg1

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (G:) Mycoplasma arthritidis mitogen

SCOP Domain Sequences for d2icwg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwg1 a.202.1.1 (G:1-213) Superantigen MAM {Mycoplasma arthritidis [TaxId: 2111]}
mklrvenpkkaqkhfvqnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrhaf
givndynglleykeifnmmflklsvvfdtqrkeannveqikrniaildeimakadndlsy
fisqnknfqelwdkavkltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwfr
sllvkgvylikryyegdielkttsdfakavfed

SCOP Domain Coordinates for d2icwg1:

Click to download the PDB-style file with coordinates for d2icwg1.
(The format of our PDB-style files is described here.)

Timeline for d2icwg1: