Class a: All alpha proteins [46456] (284 folds) |
Fold a.202: Superantigen MAM [101343] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.202.1: Superantigen MAM [101344] (1 family) |
Family a.202.1.1: Superantigen MAM [101345] (1 protein) |
Protein Superantigen MAM [101346] (1 species) |
Species Mycoplasma arthritidis [TaxId:2111] [101347] (3 PDB entries) |
Domain d2icwg1: 2icw G:1-213 [137251] Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwj1, d2icwl1 automatically matched to d1r5id_ mutant |
PDB Entry: 2icw (more details), 2.41 Å
SCOP Domain Sequences for d2icwg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icwg1 a.202.1.1 (G:1-213) Superantigen MAM {Mycoplasma arthritidis [TaxId: 2111]} mklrvenpkkaqkhfvqnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrhaf givndynglleykeifnmmflklsvvfdtqrkeannveqikrniaildeimakadndlsy fisqnknfqelwdkavkltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwfr sllvkgvylikryyegdielkttsdfakavfed
Timeline for d2icwg1: