Lineage for d2icwa2 (2icw A:13-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856736Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 856809Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)
  8. 856817Domain d2icwa2: 2icw A:13-81 [137244]
    Other proteins in same PDB: d2icwa1, d2icwb1, d2icwb2, d2icwd1, d2icwe1, d2icwe2, d2icwg1, d2icwh1, d2icwj1, d2icwl1
    automatically matched to d1k2da2
    mutant

Details for d2icwa2

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOP Domain Sequences for d2icwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwa2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

SCOP Domain Coordinates for d2icwa2:

Click to download the PDB-style file with coordinates for d2icwa2.
(The format of our PDB-style files is described here.)

Timeline for d2icwa2: