SCOPe 2.01: Domain d2icwe1: 2icw E:93-190

Lineage for d2icwe1 (2icw E:93-190)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d2icwe1: 2icw E:93-190 [137249]
   Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb2, d2icwd1, d2icwd2, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwl_
   automatically matched to d1d5xb1

Details for d2icwe1

PDB Entry: 2icw, 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule

PDB Compounds: (E:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2icwe1:

Sequence, based on SEQRES records:

>d2icwe1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d2icwe1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqt
lvmletvprsgevytcqvehpsvtspltvewra

Timeline for d2icwe1:

• d2icwe1 first appeared in SCOP 1.73
  
• d2icwe1 appears in SCOP 1.75
  
• d2icwe1 appears in SCOPe 2.02
  
• d2icwe1 appears in the current release, SCOPe 2.08