Lineage for d2icwe1 (2icw E:93-190)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654956Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 654964Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (38 PDB entries)
    probably orthologous to the mouse I-E group
  8. 654989Domain d2icwe1: 2icw E:93-190 [137249]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb2, d2icwd1, d2icwd2, d2icwe2, d2icwg1, d2icwh1
    automatically matched to d1d5xb1
    mutant

Details for d2icwe1

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (E:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2icwe1:

Sequence, based on SEQRES records: (download)

>d2icwe1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d2icwe1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqt
lvmletvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d2icwe1:

Click to download the PDB-style file with coordinates for d2icwe1.
(The format of our PDB-style files is described here.)

Timeline for d2icwe1: