Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Hedgehog receptor iHog [141061] (1 species) Cg9211-PA |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries) Uniprot Q9VM64 466-572! Uniprot Q9VM64 573-667 |
Domain d2ibgd2: 2ibg D:466-572 [137189] Other proteins in same PDB: d2ibga3, d2ibgb3, d2ibgc3, d2ibgd3, d2ibge1, d2ibgf_, d2ibgg_, d2ibgh_ automated match to d2ibga2 complexed with po4 |
PDB Entry: 2ibg (more details), 2.2 Å
SCOPe Domain Sequences for d2ibgd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibgd2 b.1.2.1 (D:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ypptppnvtrlsdesvmlrwmvprndglpivifkvqyrmvgkrknwqttndnipygkpkw nselgksftasvtdlkpqhtyrfrilavysnndnkesntsakfylqp
Timeline for d2ibgd2: