![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Hedgehog receptor iHog [141061] (1 species) Cg9211-PA |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries) Uniprot Q9VM64 466-572! Uniprot Q9VM64 573-667 |
![]() | Domain d2ibgc1: 2ibg C:573-676 [137186] Other proteins in same PDB: d2ibga3, d2ibgb3, d2ibgc3, d2ibgd3, d2ibge1, d2ibgf_, d2ibgg_, d2ibgh_ automated match to d2ibga1 complexed with po4 |
PDB Entry: 2ibg (more details), 2.2 Å
SCOPe Domain Sequences for d2ibgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibgc1 b.1.2.1 (C:573-676) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gaaldpmpvpelleieeysetavvlhwslasdadehlitgyyayyrpsssageyfkatie gaharsfkiapletatmyefklqsfsaasasefsalkqgrtqrp
Timeline for d2ibgc1: