Lineage for d2ibga2 (2ibg A:466-572)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2359214Protein Hedgehog receptor iHog [141061] (1 species)
    Cg9211-PA
  7. 2359215Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries)
    Uniprot Q9VM64 466-572! Uniprot Q9VM64 573-667
  8. 2359219Domain d2ibga2: 2ibg A:466-572 [137183]
    Other proteins in same PDB: d2ibga3, d2ibgb3, d2ibgc3, d2ibgd3, d2ibge1, d2ibgf_, d2ibgg_, d2ibgh_
    complexed with po4

Details for d2ibga2

PDB Entry: 2ibg (more details), 2.2 Å

PDB Description: Crystal Structure of Hedgehog Bound to the FNIII Domains of Ihog
PDB Compounds: (A:) cg9211-pa

SCOPe Domain Sequences for d2ibga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibga2 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ypptppnvtrlsdesvmlrwmvprndglpivifkvqyrmvgkrknwqttndnipygkpkw
nselgksftasvtdlkpqhtyrfrilavysnndnkesntsakfylqp

SCOPe Domain Coordinates for d2ibga2:

Click to download the PDB-style file with coordinates for d2ibga2.
(The format of our PDB-style files is described here.)

Timeline for d2ibga2: