Lineage for d2ibgf_ (2ibg F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523399Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2523400Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2523405Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 2523406Protein Hedgehog [143496] (1 species)
    lacks the conserved metal ion-binding site
  7. 2523407Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [143497] (1 PDB entry)
    Uniprot Q02936 50-198
  8. 2523409Domain d2ibgf_: 2ibg F: [137191]
    Other proteins in same PDB: d2ibga1, d2ibga2, d2ibga3, d2ibgb1, d2ibgb2, d2ibgb3, d2ibgc1, d2ibgc2, d2ibgc3, d2ibgd1, d2ibgd2, d2ibgd3
    automated match to d1vhh__
    complexed with po4

Details for d2ibgf_

PDB Entry: 2ibg (more details), 2.2 Å

PDB Description: Crystal Structure of Hedgehog Bound to the FNIII Domains of Ihog
PDB Compounds: (F:) Protein hedgehog

SCOPe Domain Sequences for d2ibgf_:

Sequence, based on SEQRES records: (download)

>d2ibgf_ d.65.1.2 (F:) Hedgehog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lyplvlkqtipnlseytnsasgplegvirrdspkfkdlvpnynrdilfrdeegtgadrlm
skrckeklnvlaysvmnewpgirllvteswdedyhhgqeslhyegravtiatsdrdqsky
gmlarlaveagfdwvsyvsrrhiycsvk

Sequence, based on observed residues (ATOM records): (download)

>d2ibgf_ d.65.1.2 (F:) Hedgehog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lyplvlkqtipnlseytnsasgplegvirrdspkfkdlvpnynrdilfrdrlmskrckek
lnvlaysvmnewpgirllvteseslhyegravtiatsdrdqskygmlarlaveagfdwvs
yvsrrhiycsvk

SCOPe Domain Coordinates for d2ibgf_:

Click to download the PDB-style file with coordinates for d2ibgf_.
(The format of our PDB-style files is described here.)

Timeline for d2ibgf_: