SCOPe 2.08: Domain d2ia5l2: 2ia5 L:1-152

Lineage for d2ia5l2 (2ia5 L:1-152)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Polynucleotide kinase, kinase domain [75191] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [75192] (6 PDB entries)

8. Domain d2ia5l2: 2ia5 L:1-152 [137156]
   Other proteins in same PDB: d2ia5a1, d2ia5b1, d2ia5c1, d2ia5d1, d2ia5e1, d2ia5f1, d2ia5g1, d2ia5h1, d2ia5i1, d2ia5j1, d2ia5k1, d2ia5l1
   automated match to d1ltqa2
   complexed with ars, mg, so4

Details for d2ia5l2

PDB Entry: 2ia5, 2.9 Å

PDB Description: t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.

PDB Compounds: (L:) Polynucleotide kinase

SCOPe Domain Sequences for d2ia5l2:

Sequence; same for both SEQRES and ATOM records:

>d2ia5l2 c.37.1.1 (L:1-152) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}
mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
krnskrgtkavpidvlrsmyksmreylglpvy

Timeline for d2ia5l2:

• d2ia5l2 first appeared in SCOP 1.73
  
• d2ia5l2 appears in SCOPe 2.07