SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ia5h2 (2ia5 H:1-152)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109563Protein Polynucleotide kinase, kinase domain [75191] (1 species)
  7. 2109564Species Bacteriophage T4 [TaxId:10665] [75192] (6 PDB entries)
  8. 2109576Domain d2ia5h2: 2ia5 H:1-152 [137148]
    Other proteins in same PDB: d2ia5a1, d2ia5b1, d2ia5c1, d2ia5d1, d2ia5e1, d2ia5f1, d2ia5g1, d2ia5h1, d2ia5i1, d2ia5j1, d2ia5k1, d2ia5l1
    automated match to d1ltqa2
    complexed with ars, mg, so4

Details for d2ia5h2

PDB Entry: 2ia5 (more details), 2.9 Å

PDB Description: T4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.
PDB Compounds: (H:) Polynucleotide kinase

SCOPe Domain Sequences for d2ia5h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ia5h2 c.37.1.1 (H:1-152) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}
mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
krnskrgtkavpidvlrsmyksmreylglpvy

SCOPe Domain Coordinates for d2ia5h2:

Click to download the PDB-style file with coordinates for d2ia5h2.
(The format of our PDB-style files is described here.)

Timeline for d2ia5h2: