![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Polynucleotide kinase, kinase domain [75191] (1 species) |
![]() | Species Bacteriophage T4 [TaxId:10665] [75192] (6 PDB entries) |
![]() | Domain d2ia5g2: 2ia5 G:3-152 [137146] Other proteins in same PDB: d2ia5a1, d2ia5b1, d2ia5c1, d2ia5d1, d2ia5e1, d2ia5f1, d2ia5g1, d2ia5h1, d2ia5i1, d2ia5j1, d2ia5k1, d2ia5l1 automated match to d1ltqa2 complexed with ars, mg, so4 |
PDB Entry: 2ia5 (more details), 2.9 Å
SCOPe Domain Sequences for d2ia5g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ia5g2 c.37.1.1 (G:3-152) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} kiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegivtg mqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelvkr nskrgtkavpidvlrsmyksmreylglpvy
Timeline for d2ia5g2: