![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.9: phosphatase domain of polynucleotide kinase [82385] (2 proteins) no insertion subdomains |
![]() | Protein Polynucleotide kinase, phosphatase domain [82386] (1 species) |
![]() | Species Bacteriophage T4 [TaxId:10665] [82387] (5 PDB entries) |
![]() | Domain d2ia5h1: 2ia5 H:153-301 [137147] Other proteins in same PDB: d2ia5a2, d2ia5b2, d2ia5c2, d2ia5d2, d2ia5e2, d2ia5f2, d2ia5g2, d2ia5h2, d2ia5i2, d2ia5j2, d2ia5k2, d2ia5l2 automated match to d1ltqa1 complexed with ars, mg, so4 |
PDB Entry: 2ia5 (more details), 2.9 Å
SCOPe Domain Sequences for d2ia5h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ia5h1 c.108.1.9 (H:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} ngtpgkpkavifdvdgtlakmngrgpydlekcdtdvinpmvvelskmyalmgyqivvvsg resgtkedptkyyrmtrkwvediagvplvmqcqreqgdtrkddvvkeeifwkhiaphfdv klaiddrtqvvemwrrigvecwqvasgdf
Timeline for d2ia5h1: