Lineage for d2ia5h1 (2ia5 H:153-301)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919923Family c.108.1.9: phosphatase domain of polynucleotide kinase [82385] (2 proteins)
    no insertion subdomains
  6. 2919928Protein Polynucleotide kinase, phosphatase domain [82386] (1 species)
  7. 2919929Species Bacteriophage T4 [TaxId:10665] [82387] (5 PDB entries)
  8. 2919941Domain d2ia5h1: 2ia5 H:153-301 [137147]
    Other proteins in same PDB: d2ia5a2, d2ia5b2, d2ia5c2, d2ia5d2, d2ia5e2, d2ia5f2, d2ia5g2, d2ia5h2, d2ia5i2, d2ia5j2, d2ia5k2, d2ia5l2
    automated match to d1ltqa1
    complexed with ars, mg, so4

Details for d2ia5h1

PDB Entry: 2ia5 (more details), 2.9 Å

PDB Description: t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.
PDB Compounds: (H:) Polynucleotide kinase

SCOPe Domain Sequences for d2ia5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ia5h1 c.108.1.9 (H:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}
ngtpgkpkavifdvdgtlakmngrgpydlekcdtdvinpmvvelskmyalmgyqivvvsg
resgtkedptkyyrmtrkwvediagvplvmqcqreqgdtrkddvvkeeifwkhiaphfdv
klaiddrtqvvemwrrigvecwqvasgdf

SCOPe Domain Coordinates for d2ia5h1:

Click to download the PDB-style file with coordinates for d2ia5h1.
(The format of our PDB-style files is described here.)

Timeline for d2ia5h1: