| Class g: Small proteins [56992] (91 folds) |
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
| Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
| Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries) Uniprot P62877 19-106 |
| Domain d2hyed_: 2hye D: [136879] Other proteins in same PDB: d2hyeb_, d2hyec1, d2hyec2, d2hyec3 automated match to d3dplr_ complexed with zn |
PDB Entry: 2hye (more details), 3.1 Å
SCOPe Domain Sequences for d2hyed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyed_ g.44.1.1 (D:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqkygh
Timeline for d2hyed_:
View in 3DDomains from other chains: (mouse over for more information) d2hyeb_, d2hyec1, d2hyec2, d2hyec3 |