Lineage for d2hyec1 (2hye C:676-759)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479458Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)
  6. 1479473Protein Cullin-4A [158288] (1 species)
  7. 1479474Species Human (Homo sapiens) [TaxId:9606] [158289] (1 PDB entry)
    Uniprot Q13619 676-759
  8. 1479475Domain d2hyec1: 2hye C:676-759 [145414]
    Other proteins in same PDB: d2hyeb_, d2hyec2, d2hyec3, d2hyed_
    complexed with zn

Details for d2hyec1

PDB Entry: 2hye (more details), 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex
PDB Compounds: (C:) Cullin-4A

SCOPe Domain Sequences for d2hyec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyec1 a.4.5.34 (C:676-759) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]}
etveeqvsttervfqdrqyqidaaivrimkmrktlghnllvselynqlkfpvkpgdlkkr
ieslidrdymerdkdnpnqyhyva

SCOPe Domain Coordinates for d2hyec1:

Click to download the PDB-style file with coordinates for d2hyec1.
(The format of our PDB-style files is described here.)

Timeline for d2hyec1: