Lineage for d2hyed_ (2hye D:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1966943Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1966944Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1966945Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 1966977Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 1966978Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
    Uniprot P62877 19-106
  8. 1966988Domain d2hyed_: 2hye D: [136879]
    Other proteins in same PDB: d2hyeb_, d2hyec1, d2hyec2, d2hyec3
    automated match to d3dplr_
    complexed with zn

Details for d2hyed_

PDB Entry: 2hye (more details), 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex
PDB Compounds: (D:) RING-box protein 1

SCOPe Domain Sequences for d2hyed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyed_ g.44.1.1 (D:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqkygh

SCOPe Domain Coordinates for d2hyed_:

Click to download the PDB-style file with coordinates for d2hyed_.
(The format of our PDB-style files is described here.)

Timeline for d2hyed_: