SCOPe 2.08: Domain d2hyed_: 2hye D:

Lineage for d2hyed_ (2hye D:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
   Uniprot P62877 19-106

8. Domain d2hyed_: 2hye D: [136879]
   Other proteins in same PDB: d2hyeb_, d2hyec1, d2hyec2, d2hyec3
   automated match to d3dplr_
   complexed with zn
   has additional insertions and/or extensions that are not grouped together

Details for d2hyed_

PDB Entry: 2hye, 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex

PDB Compounds: (D:) RING-box protein 1

SCOPe Domain Sequences for d2hyed_:

Sequence; same for both SEQRES and ATOM records:

>d2hyed_ g.44.1.1 (D:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqkygh

Timeline for d2hyed_:

• d2hyed_ first appeared in SCOP 1.73, called d2hyed1
  
• d2hyed_ appears in SCOPe 2.07