SCOPe 2.03: Domain d2hyed1: 2hye D:19-106

Lineage for d2hyed1 (2hye D:19-106)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)

6. Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75694] (6 PDB entries)
   Uniprot P62877 19-106

8. Domain d2hyed1: 2hye D:19-106 [136879]
   Other proteins in same PDB: d2hyec1, d2hyec2, d2hyec3
   automatically matched to d1ldjb_
   complexed with zn

Details for d2hyed1

PDB Entry: 2hye, 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex

PDB Compounds: (D:) RING-box protein 1

SCOPe Domain Sequences for d2hyed1:

Sequence; same for both SEQRES and ATOM records:

>d2hyed1 g.44.1.1 (D:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqky

Timeline for d2hyed1:

• d2hyed1 first appeared in SCOP 1.73
  
• d2hyed1 appears in SCOPe 2.02
  
• d2hyed1 is called d2hyed_ in SCOPe 2.04
  
• d2hyed1 appears in the current release, SCOPe 2.08, called d2hyed_