Lineage for d2hyec2 (2hye C:55-401)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279812Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 1279813Family a.118.17.1: Cullin repeat [74789] (2 proteins)
    this is a repeat family; one repeat unit is 1u6g A:175-198 found in domain
  6. 1279819Protein Cullin-4A [158789] (1 species)
  7. 1279820Species Human (Homo sapiens) [TaxId:9606] [158790] (1 PDB entry)
    Uniprot Q13619 55-401
  8. 1279821Domain d2hyec2: 2hye C:55-401 [145415]
    Other proteins in same PDB: d2hyec1, d2hyec3, d2hyed1
    complexed with zn

Details for d2hyec2

PDB Entry: 2hye (more details), 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex
PDB Compounds: (C:) Cullin-4A

SCOPe Domain Sequences for d2hyec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyec2 a.118.17.1 (C:55-401) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]}
pdnytqdtwrklheavravqsstsirynleelyqavenlcshkvspmlykqlrqacedhv
qaqilpfredsldsvlflkkintcwqdhcrqmimirsiflfldrtyvlqnstlpsiwdmg
lelfrthiisdkmvqsktidgilllierersgeavdrsllrsllgmlsdlqvykdsfelk
fleetnclyaaegqrlmqerevpeylnhvskrleeegdrvityldhstqkpliacvekql
lgehltailqkgldhlldenrvpdlaqmyqlfsrvrggqqallqhwseyiktfgtaivin
pekdkdmvqdlldfkdkvdhvievcfqknerfvnlmkesfetfinkr

SCOPe Domain Coordinates for d2hyec2:

Click to download the PDB-style file with coordinates for d2hyec2.
(The format of our PDB-style files is described here.)

Timeline for d2hyec2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hyed1