SCOPe 2.08: Domain d2hv4a_: 2hv4 A:

Lineage for d2hv4a_ (2hv4 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
   Uniprot P00044

8. Domain d2hv4a_: 2hv4 A: [136782]
   automated match to d3tyia_
   complexed with hec

Details for d2hv4a_

PDB Entry: 2hv4

PDB Description: nmr solution structure refinement of yeast iso-1-ferrocytochrome c

PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d2hv4a_:

Sequence; same for both SEQRES and ATOM records:

>d2hv4a_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d2hv4a_:

• d2hv4a_ first appeared in SCOP 1.73, called d2hv4a1
  
• d2hv4a_ appears in SCOPe 2.07