SCOP 1.73: Domain d2hv4a1: 2hv4 A:-5-103

Lineage for d2hv4a1 (2hv4 A:-5-103)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (39 PDB entries)

8. Domain d2hv4a1: 2hv4 A:-5-103 [136782]
   automatically matched to d1nmia_
   complexed with hec; mutant

Details for d2hv4a1

PDB Entry: 2hv4

PDB Description: nmr solution structure refinement of yeast iso-1-ferrocytochrome c

PDB Compounds: (A:) Cytochrome c iso-1

SCOP Domain Sequences for d2hv4a1:

Sequence; same for both SEQRES and ATOM records:

>d2hv4a1 a.3.1.1 (A:-5-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d2hv4a1:

• d2hv4a1 is new in SCOP 1.73
  
• d2hv4a1 appears in SCOP 1.75
  
• d2hv4a1 appears in the current release, SCOPe 2.08, called d2hv4a_