Lineage for d2hv4a1 (2hv4 A:-5-103)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 633998Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 633999Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (39 PDB entries)
  8. 634035Domain d2hv4a1: 2hv4 A:-5-103 [136782]
    automatically matched to d1nmia_
    complexed with hec; mutant

Details for d2hv4a1

PDB Entry: 2hv4 (more details)

PDB Description: NMR solution structure refinement of yeast iso-1-ferrocytochrome c
PDB Compounds: (A:) Cytochrome c iso-1

SCOP Domain Sequences for d2hv4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv4a1 a.3.1.1 (A:-5-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOP Domain Coordinates for d2hv4a1:

Click to download the PDB-style file with coordinates for d2hv4a1.
(The format of our PDB-style files is described here.)

Timeline for d2hv4a1: