Lineage for d2guba_ (2gub A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. Protein automated matches [190298] (3 species)
    not a true protein
  7. Species Streptomyces rubiginosus [TaxId:1929] [187248] (17 PDB entries)
  8. Domain d2guba_: 2gub A: [135729]
    automated match to d1dxia_

Details for d2guba_

PDB Entry: 2gub (more details), 1.8 Å

PDB Description: Crystal Structure of Metal Free D-Xylose Isomerase.
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d2guba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2guba_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]}
yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipfg
ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn
idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep
kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas
aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv
daaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d2guba_ are not available.

Timeline for d2guba_: