PDB entry 2gub

View 2gub on RCSB PDB site
Description: Crystal Structure of Metal Free D-Xylose Isomerase.
Class: isomerase
Keywords: TIM barrel, beta-alpha-barrel, metal-free, inactive enzyme, sugar interconversion, ISOMERASE
Deposited on 2006-04-29, released 2006-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Streptomyces rubiginosus [TaxId:1929]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2guba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gubA (A:)
    mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
    fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
    rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
    epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
    lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
    asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
    dvdaaaargmaferldqlamdhllgarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gubA (A:)
    yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipfg
    ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn
    idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep
    kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
    hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas
    aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv
    daaaargmaferldqlamdhllgar