Lineage for d2guba1 (2gub A:3-387)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685236Superfamily c.1.15: Xylose isomerase-like [51658] (7 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 685259Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 685260Protein D-xylose isomerase [51666] (12 species)
  7. 685388Species Streptomyces rubiginosus [TaxId:1929] [51670] (23 PDB entries)
  8. 685410Domain d2guba1: 2gub A:3-387 [135729]
    automatically matched to d1mnza_

Details for d2guba1

PDB Entry: 2gub (more details), 1.8 Å

PDB Description: Crystal Structure of Metal Free D-Xylose Isomerase.
PDB Compounds: (A:) xylose isomerase

SCOP Domain Sequences for d2guba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2guba1 c.1.15.3 (A:3-387) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipfg
ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn
idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep
kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas
aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv
daaaargmaferldqlamdhllgar

SCOP Domain Coordinates for d2guba1:

Click to download the PDB-style file with coordinates for d2guba1.
(The format of our PDB-style files is described here.)

Timeline for d2guba1: