SCOPe 2.08: Domain d2gjwb3: 2gjw B:5-62

Lineage for d2gjwb3 (2gjw B:5-62)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family)

5. Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)

6. Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species)
   duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats

7. Species Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries)

8. Domain d2gjwb3: 2gjw B:5-62 [135301]
   Other proteins in same PDB: d2gjwa1, d2gjwa2, d2gjwa5, d2gjwb1, d2gjwb2, d2gjwb5, d2gjwc1, d2gjwc2, d2gjwc5, d2gjwd1, d2gjwd2
   automatically matched to d1rlva3
   protein/RNA complex

Details for d2gjwb3

PDB Entry: 2gjw, 2.85 Å

PDB Description: RNA Recognition and Cleavage by an Splicing Endonuclease

PDB Compounds: (B:) tRNA-splicing endonuclease

SCOPe Domain Sequences for d2gjwb3:

Sequence; same for both SEQRES and ATOM records:

>d2gjwb3 d.75.1.1 (B:5-62) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeoglobus fulgidus [TaxId: 2234]}
ggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm

Timeline for d2gjwb3:

• d2gjwb3 first appeared in SCOP 1.73
  
• d2gjwb3 appears in SCOPe 2.07