Lineage for d2gjwa4 (2gjw A:143-217)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family) (S)
  5. Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)
  6. Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species)
    duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats
  7. Species Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries)
  8. Domain d2gjwa4: 2gjw A:143-217 [135298]
    Other proteins in same PDB: d2gjwa1, d2gjwa2, d2gjwa5, d2gjwb1, d2gjwb2, d2gjwb5, d2gjwc1, d2gjwc2, d2gjwc5, d2gjwd1, d2gjwd2
    automatically matched to d1r0va3
    protein/RNA complex

Details for d2gjwa4

PDB Entry: 2gjw (more details), 2.85 Å

PDB Description: RNA Recognition and Cleavage by an Splicing Endonuclease
PDB Compounds: (A:) tRNA-splicing endonuclease

SCOPe Domain Sequences for d2gjwa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjwa4 d.75.1.1 (A:143-217) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeoglobus fulgidus [TaxId: 2234]}
geqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtlslieslylldlgklnlln
adreelvkrarever

SCOPe Domain Coordinates for d2gjwa4 are not available.

Timeline for d2gjwa4:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gjwa1, d2gjwa2, d2gjwa3, d2gjwa5
View in 3D
Domains from other chains:
(mouse over for more information)
d2gjwb1, d2gjwb2, d2gjwb3, d2gjwb4, d2gjwb5, d2gjwc1, d2gjwc2, d2gjwc3, d2gjwc4, d2gjwc5, d2gjwd1, d2gjwd2, d2gjwd3, d2gjwd4