Lineage for d2gjwd3 (2gjw D:5-63)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524818Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524819Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family) (S)
  5. 2524820Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)
  6. 2524821Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species)
    duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats
  7. 2524822Species Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries)
  8. 2524837Domain d2gjwd3: 2gjw D:5-63 [135309]
    Other proteins in same PDB: d2gjwa1, d2gjwa2, d2gjwa5, d2gjwb1, d2gjwb2, d2gjwb5, d2gjwc1, d2gjwc2, d2gjwc5, d2gjwd1, d2gjwd2
    automatically matched to d1rlva3
    protein/RNA complex

Details for d2gjwd3

PDB Entry: 2gjw (more details), 2.85 Å

PDB Description: RNA Recognition and Cleavage by an Splicing Endonuclease
PDB Compounds: (D:) tRNA-splicing endonuclease

SCOPe Domain Sequences for d2gjwd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjwd3 d.75.1.1 (D:5-63) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeoglobus fulgidus [TaxId: 2234]}
iggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm

SCOPe Domain Coordinates for d2gjwd3:

Click to download the PDB-style file with coordinates for d2gjwd3.
(The format of our PDB-style files is described here.)

Timeline for d2gjwd3: