Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family) |
Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins) |
Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species) duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats |
Species Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries) |
Domain d2gjwa3: 2gjw A:5-63 [135297] Other proteins in same PDB: d2gjwa1, d2gjwa2, d2gjwa5, d2gjwb1, d2gjwb2, d2gjwb5, d2gjwc1, d2gjwc2, d2gjwc5, d2gjwd1, d2gjwd2 automatically matched to d1rlva3 protein/RNA complex |
PDB Entry: 2gjw (more details), 2.85 Å
SCOPe Domain Sequences for d2gjwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gjwa3 d.75.1.1 (A:5-63) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeoglobus fulgidus [TaxId: 2234]} iggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
Timeline for d2gjwa3:
View in 3D Domains from same chain: (mouse over for more information) d2gjwa1, d2gjwa2, d2gjwa4, d2gjwa5 |