Lineage for d2gjwc4 (2gjw C:142-216)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958349Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2958350Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family) (S)
  5. 2958351Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)
  6. 2958352Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species)
    duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats
  7. 2958353Species Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries)
  8. 2958367Domain d2gjwc4: 2gjw C:142-216 [135306]
    Other proteins in same PDB: d2gjwa1, d2gjwa2, d2gjwa5, d2gjwb1, d2gjwb2, d2gjwb5, d2gjwc1, d2gjwc2, d2gjwc5, d2gjwd1, d2gjwd2
    automatically matched to d1r0va3
    protein/RNA complex

Details for d2gjwc4

PDB Entry: 2gjw (more details), 2.85 Å

PDB Description: RNA Recognition and Cleavage by an Splicing Endonuclease
PDB Compounds: (C:) tRNA-splicing endonuclease

SCOPe Domain Sequences for d2gjwc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjwc4 d.75.1.1 (C:142-216) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeoglobus fulgidus [TaxId: 2234]}
geqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtlslieslylldlgklnlln
adreelvkrarever

SCOPe Domain Coordinates for d2gjwc4:

Click to download the PDB-style file with coordinates for d2gjwc4.
(The format of our PDB-style files is described here.)

Timeline for d2gjwc4: