Lineage for d2gj8d2 (2gj8 D:216-384)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868061Species Escherichia coli [TaxId:469008] [187117] (4 PDB entries)
  8. 2868065Domain d2gj8d2: 2gj8 D:216-384 [135273]
    Other proteins in same PDB: d2gj8d3
    automated match to d1rfla_
    complexed with alf, gdp, k, mg, se

Details for d2gj8d2

PDB Entry: 2gj8 (more details), 1.7 Å

PDB Description: Structure of the MnmE G-domain in complex with GDP*AlF4-, Mg2+ and K+
PDB Compounds: (D:) tRNA modification GTPase trmE

SCOPe Domain Sequences for d2gj8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj8d2 c.37.1.8 (D:216-384) automated matches {Escherichia coli [TaxId: 469008]}
gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr
easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn
kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsmgfdtnmeg

SCOPe Domain Coordinates for d2gj8d2:

Click to download the PDB-style file with coordinates for d2gj8d2.
(The format of our PDB-style files is described here.)

Timeline for d2gj8d2: