![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (37 species) not a true protein |
![]() | Species Escherichia coli [TaxId:469008] [187117] (4 PDB entries) |
![]() | Domain d2gj8c_: 2gj8 C: [135272] Other proteins in same PDB: d2gj8d3 automated match to d1rfla_ complexed with alf, gdp, k, mg, se |
PDB Entry: 2gj8 (more details), 1.7 Å
SCOPe Domain Sequences for d2gj8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj8c_ c.37.1.8 (C:) automated matches {Escherichia coli [TaxId: 469008]} gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsm
Timeline for d2gj8c_:
![]() Domains from other chains: (mouse over for more information) d2gj8a_, d2gj8b_, d2gj8d2, d2gj8d3 |