Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Probable tRNA modification GTPase TrmE (MnmE), G domain [102366] (1 species) |
Species Escherichia coli [TaxId:562] [102367] (4 PDB entries) |
Domain d2gj8d1: 2gj8 D:216-376 [135273] automatically matched to d1rfla_ complexed with alf, gdp, k, mg, se |
PDB Entry: 2gj8 (more details), 1.7 Å
SCOP Domain Sequences for d2gj8d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj8d1 c.37.1.8 (D:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} gmkvviagrpnagkssllnalagreaaivtdiagttrdvlrehihidgmplhiidtaglr easdeverigierawqeieqadrvlfmvdgtttdavdpaeiwpefiarlpaklpitvvrn kaditgetlgmsevnghalirlsartgegvdvlrnhlkqsm
Timeline for d2gj8d1: