![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Putative transcriptional regulator Atu0279 [140211] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [140212] (1 PDB entry) Uniprot Q8UIL4 3-76 |
![]() | Domain d2g7sa1: 2g7s A:3-76 [134737] Other proteins in same PDB: d2g7sa2 |
PDB Entry: 2g7s (more details), 1.4 Å
SCOPe Domain Sequences for d2g7sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]} npqskaddilqcartliirggynsfsyadisqvvgirnasihhhfpsksdlvcklvsqyr qeaeagiaelekni
Timeline for d2g7sa1: