Lineage for d2g7sa1 (2g7s A:3-76)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Putative transcriptional regulator Atu0279 [140211] (1 species) Species Agrobacterium tumefaciens [TaxId:358] [140212] (1 PDB entry)
Uniprot Q8UIL4 3-76
Domain d2g7sa1: 2g7s A:3-76 [134737]
Other proteins in same PDB: d2g7sa2
Details for d2g7sa1
PDB Entry: 2g7s (more details), 1.4 Å
PDB Description: the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILYSCOPe Domain Sequences for d2g7sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]}
npqskaddilqcartliirggynsfsyadisqvvgirnasihhhfpsksdlvcklvsqyr
qeaeagiaelekni
SCOPe Domain Coordinates for d2g7sa1:
Click to download the PDB-style file with coordinates for d2g7sa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g7sa1:
- d2g7sa1 first appeared in SCOP 1.73
- d2g7sa1 appears in SCOPe 2.07
View in 3D
