Lineage for d2g7sa1 (2g7s A:3-76)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981736Protein Putative transcriptional regulator Atu0279 [140211] (1 species)
  7. 1981737Species Agrobacterium tumefaciens [TaxId:358] [140212] (1 PDB entry)
    Uniprot Q8UIL4 3-76
  8. 1981738Domain d2g7sa1: 2g7s A:3-76 [134737]
    Other proteins in same PDB: d2g7sa2

Details for d2g7sa1

PDB Entry: 2g7s (more details), 1.4 Å

PDB Description: the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d2g7sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]}
npqskaddilqcartliirggynsfsyadisqvvgirnasihhhfpsksdlvcklvsqyr
qeaeagiaelekni

SCOPe Domain Coordinates for d2g7sa1:

Click to download the PDB-style file with coordinates for d2g7sa1.
(The format of our PDB-style files is described here.)

Timeline for d2g7sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g7sa2