Lineage for d2g7sa2 (2g7s A:77-192)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008309Protein Putative transcriptional regulator Atu0279 [140911] (1 species)
  7. 2008310Species Agrobacterium tumefaciens [TaxId:358] [140912] (1 PDB entry)
    Uniprot Q8UIL4 77-192
  8. 2008311Domain d2g7sa2: 2g7s A:77-192 [134738]
    Other proteins in same PDB: d2g7sa1

Details for d2g7sa2

PDB Entry: 2g7s (more details), 1.4 Å

PDB Description: the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d2g7sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g7sa2 a.121.1.1 (A:77-192) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]}
sdpleqlrayigywegciadathpfcvcallaseipvlpetvvlevrahfrslsdwltav
lergiaqgrlvltgtaranaeifmatvhgamlsarahgdaatfgaitrpmlerita

SCOPe Domain Coordinates for d2g7sa2:

Click to download the PDB-style file with coordinates for d2g7sa2.
(The format of our PDB-style files is described here.)

Timeline for d2g7sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g7sa1