SCOPe 2.08: Domain d2ff4a1: 2ff4 A:10-104

Lineage for d2ff4a1 (2ff4 A:10-104)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.1: PhoB-like [46895] (6 proteins)
   contains 4-stranded meander beta-sheet in the N-terminal extension

6. Protein Probable regulatory protein EmbR [140313] (1 species)
   N-terminal domain, unlike the other members

7. Species Mycobacterium tuberculosis [TaxId:1773] [140314] (2 PDB entries)
   Uniprot P66799 10-104

8. Domain d2ff4a1: 2ff4 A:10-104 [133367]
   Other proteins in same PDB: d2ff4a2, d2ff4a3, d2ff4b2, d2ff4b3
   automatically matched to 2FEZ A:10-104

Details for d2ff4a1

PDB Entry: 2ff4, 1.9 Å

PDB Description: Mycobacterium tuberculosis EmbR in complex with low affinity phosphopeptide

PDB Compounds: (A:) Probable regulatory protein embR

SCOPe Domain Sequences for d2ff4a1:

Sequence; same for both SEQRES and ATOM records:

>d2ff4a1 a.4.6.1 (A:10-104) Probable regulatory protein EmbR {Mycobacterium tuberculosis [TaxId: 1773]}
rldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalweewppsgar
asihsyvsnlrkllggagidprvvlaaappgyrls

Timeline for d2ff4a1:

• d2ff4a1 first appeared in SCOP 1.73
  
• d2ff4a1 appears in SCOPe 2.07