![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.1: PhoB-like [46895] (5 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
![]() | Protein Probable regulatory protein EmbR [140313] (1 species) N-terminal domain, unlike the other members |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [140314] (2 PDB entries) |
![]() | Domain d2ff4a1: 2ff4 A:10-104 [133367] Other proteins in same PDB: d2ff4a2, d2ff4a3, d2ff4b2, d2ff4b3 automatically matched to 2FEZ A:10-104 |
PDB Entry: 2ff4 (more details), 1.9 Å
SCOP Domain Sequences for d2ff4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff4a1 a.4.6.1 (A:10-104) Probable regulatory protein EmbR {Mycobacterium tuberculosis [TaxId: 1773]} rldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalweewppsgar asihsyvsnlrkllggagidprvvlaaappgyrls
Timeline for d2ff4a1: