SCOPe 2.08: Domain d2f4pb_: 2f4p B:

Lineage for d2f4pb_ (2f4p B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.9: TM1287-like [89409] (5 proteins)

6. Protein Hypothetical protein TM1010 [141589] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141590] (1 PDB entry)
   Uniprot Q9X0A3 2-135

8. Domain d2f4pb_: 2f4p B: [132934]
   automated match to d2f4pa1
   complexed with edo, unl

Details for d2f4pb_

PDB Entry: 2f4p, 1.9 Å

PDB Description: Crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 A resolution

PDB Compounds: (B:) hypothetical protein TM1010

SCOPe Domain Sequences for d2f4pb_:

Sequence; same for both SEQRES and ATOM records:

>d2f4pb_ b.82.1.9 (B:) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]}
difergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqilivt
rgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlgsv
teeeyrkategk

Timeline for d2f4pb_:

• d2f4pb_ first appeared in SCOP 1.73, called d2f4pb1
  
• d2f4pb_ appears in SCOPe 2.07