Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.9: TM1287-like [89409] (5 proteins) |
Protein Hypothetical protein TM1010 [141589] (1 species) |
Species Thermotoga maritima [TaxId:2336] [141590] (1 PDB entry) Uniprot Q9X0A3 2-135 |
Domain d2f4pa1: 2f4p A:2-135 [132933] complexed with edo, unl |
PDB Entry: 2f4p (more details), 1.9 Å
SCOPe Domain Sequences for d2f4pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} vddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqili vtrgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlg svteeeyrkategk
Timeline for d2f4pa1: