Lineage for d2f4pb1 (2f4p B:4-135)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677513Family b.82.1.9: TM1287-like [89409] (4 proteins)
  6. 677517Protein Hypothetical protein TM1010 [141589] (1 species)
  7. 677518Species Thermotoga maritima [TaxId:2336] [141590] (1 PDB entry)
  8. 677520Domain d2f4pb1: 2f4p B:4-135 [132934]
    automatically matched to 2F4P A:2-135
    complexed with edo, unl

Details for d2f4pb1

PDB Entry: 2f4p (more details), 1.9 Å

PDB Description: Crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 A resolution
PDB Compounds: (B:) hypothetical protein TM1010

SCOP Domain Sequences for d2f4pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4pb1 b.82.1.9 (B:4-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]}
difergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqilivt
rgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlgsv
teeeyrkategk

SCOP Domain Coordinates for d2f4pb1:

Click to download the PDB-style file with coordinates for d2f4pb1.
(The format of our PDB-style files is described here.)

Timeline for d2f4pb1: