![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (20 families) ![]() |
![]() | Family b.82.1.9: TM1287-like [89409] (4 proteins) |
![]() | Protein Hypothetical protein TM1010 [141589] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [141590] (1 PDB entry) |
![]() | Domain d2f4pb1: 2f4p B:4-135 [132934] automatically matched to 2F4P A:2-135 complexed with edo, unl |
PDB Entry: 2f4p (more details), 1.9 Å
SCOP Domain Sequences for d2f4pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4pb1 b.82.1.9 (B:4-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} difergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqilivt rgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlgsv teeeyrkategk
Timeline for d2f4pb1: