Lineage for d2f4pc_ (2f4p C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814807Family b.82.1.9: TM1287-like [89409] (5 proteins)
  6. 2814811Protein Hypothetical protein TM1010 [141589] (1 species)
  7. 2814812Species Thermotoga maritima [TaxId:2336] [141590] (1 PDB entry)
    Uniprot Q9X0A3 2-135
  8. 2814815Domain d2f4pc_: 2f4p C: [132935]
    automated match to d2f4pa1
    complexed with edo, unl

Details for d2f4pc_

PDB Entry: 2f4p (more details), 1.9 Å

PDB Description: Crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 A resolution
PDB Compounds: (C:) hypothetical protein TM1010

SCOPe Domain Sequences for d2f4pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4pc_ b.82.1.9 (C:) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]}
ddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqiliv
trgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlgs
vteeeyrkategk

SCOPe Domain Coordinates for d2f4pc_:

Click to download the PDB-style file with coordinates for d2f4pc_.
(The format of our PDB-style files is described here.)

Timeline for d2f4pc_: