PDB entry 2f4p

View 2f4p on RCSB PDB site
Description: Crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 A resolution
Class: unknown function
Keywords: Double-stranded beta-helix fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2005-11-23, released 2006-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.164
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM1010
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm1010
    Database cross-references and differences (RAF-indexed):
    • GB AAD36075 (Start-146)
      • modified residue (36)
    Domains in SCOPe 2.08: d2f4pa1
  • Chain 'B':
    Compound: hypothetical protein TM1010
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm1010
    Database cross-references and differences (RAF-indexed):
    • GB AAD36075 (Start-146)
      • modified residue (36)
    Domains in SCOPe 2.08: d2f4pb_
  • Chain 'C':
    Compound: hypothetical protein TM1010
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm1010
    Database cross-references and differences (RAF-indexed):
    • GB AAD36075 (Start-146)
      • modified residue (36)
    Domains in SCOPe 2.08: d2f4pc_
  • Chain 'D':
    Compound: hypothetical protein TM1010
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm1010
    Database cross-references and differences (RAF-indexed):
    • GB AAD36075 (Start-146)
      • modified residue (36)
    Domains in SCOPe 2.08: d2f4pd_
  • Heterogens: UNL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f4pA (A:)
    mgsdkihhhhhhmvddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgar
    thwhshpggqilivtrgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigi
    stqvhlgpaewlgsvteeeyrkategk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4pA (A:)
    vddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqili
    vtrgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlg
    svteeeyrkategk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f4pB (B:)
    mgsdkihhhhhhmvddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgar
    thwhshpggqilivtrgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigi
    stqvhlgpaewlgsvteeeyrkategk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4pB (B:)
    difergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqilivt
    rgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlgsv
    teeeyrkategk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f4pC (C:)
    mgsdkihhhhhhmvddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgar
    thwhshpggqilivtrgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigi
    stqvhlgpaewlgsvteeeyrkategk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4pC (C:)
    ddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqiliv
    trgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlgs
    vteeeyrkategk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f4pD (D:)
    mgsdkihhhhhhmvddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgar
    thwhshpggqilivtrgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigi
    stqvhlgpaewlgsvteeeyrkategk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4pD (D:)
    ddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqiliv
    trgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlgs
    vteeeyrkategk