SCOPe 2.08: Domain d2e2he2: 2e2h E:144-215

Lineage for d2e2he2 (2e2h E:144-215)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families)
   automatically mapped to Pfam PF01191

5. Family d.78.1.1: RPB5 [55288] (2 proteins)

6. Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d2e2he2: 2e2h E:144-215 [131986]
   Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2hc2, d2e2he1, d2e2hf1, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hk1, d2e2hl1
   automatically matched to d1dzfa2
   protein/DNA complex; protein/RNA complex; complexed with gtp, mg, zn

Details for d2e2he2

PDB Entry: 2e2h, 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2e2he2:

Sequence; same for both SEQRES and ATOM records:

>d2e2he2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d2e2he2:

• d2e2he2 first appeared in SCOP 1.73
  
• d2e2he2 appears in SCOPe 2.07