Lineage for d2e2hk1 (2e2h K:1-114)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958258Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2958268Protein RPB11 [64312] (2 species)
  7. 2958269Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 2958292Domain d2e2hk1: 2e2h K:1-114 [131992]
    Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2hc2, d2e2he1, d2e2he2, d2e2hf1, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hl1
    automatically matched to d1i3qk_
    protein/DNA complex; protein/RNA complex; complexed with gtp, mg, zn

Details for d2e2hk1

PDB Entry: 2e2h (more details), 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d2e2hk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2hk1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d2e2hk1:

Click to download the PDB-style file with coordinates for d2e2hk1.
(The format of our PDB-style files is described here.)

Timeline for d2e2hk1: