Lineage for d2e2ha1 (2e2h A:2-1445)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574347Protein RBP1 [64486] (2 species)
  7. 2574348Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 2574371Domain d2e2ha1: 2e2h A:2-1445 [131981]
    Other proteins in same PDB: d2e2hb1, d2e2hc1, d2e2hc2, d2e2he1, d2e2he2, d2e2hf1, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hk1, d2e2hl1
    automatically matched to d1i50a_
    protein/DNA complex; protein/RNA complex; complexed with gtp, mg, zn

Details for d2e2ha1

PDB Entry: 2e2h (more details), 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d2e2ha1:

Sequence, based on SEQRES records: (download)

>d2e2ha1 e.29.1.2 (A:2-1445) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
ntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieht
tlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraa
mndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlk
kientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpg
idptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggl
tsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgaf
dvmi

Sequence, based on observed residues (ATOM records): (download)

>d2e2ha1 e.29.1.2 (A:2-1445) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpselvsrggcgntqptirkdglklvgswl
rvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrpsisfnesqrge
ddltfkladilkanisletlehngaphhaieeaesllqfhvatymdndiagqpqagrpvk
sirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpksiaktltypevvtpy
nidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqygwkverhimdndpvl
fnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnlhvpqseetraelsq
lcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnmlywvpdwdgviptp
aiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliidgqiifgvvekktvg
ssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdtiadgptmreiteti
aeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardkagrlaevnlkdlnnv
kqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfskddyspeskgfvens
ylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledimvhydnttrnslgnv
iqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtldpsllesgseilgdl
klqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqqtfhidhtkpsdlti
kdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatrrvlqeyrltkqafd
wvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlntfhfagvaskkvtsgvprlke
ilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdprstvi
pedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfviwsedli
ircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvle
tdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevynviasdgsyvnyrh
mallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsen
vilgqmapigtgafdvmi

SCOPe Domain Coordinates for d2e2ha1:

Click to download the PDB-style file with coordinates for d2e2ha1.
(The format of our PDB-style files is described here.)

Timeline for d2e2ha1: