| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) ![]() |
| Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins) |
| Protein RBP9 subunit of RNA polymerase II [57787] (3 species) contains two differently decorated domains of this fold |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
| Domain d2e2hi2: 2e2h I:50-120 [131990] Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2hc2, d2e2he1, d2e2he2, d2e2hf1, d2e2hh1, d2e2hj1, d2e2hk1, d2e2hl1 automatically matched to d1i3qi2 protein/DNA complex; protein/RNA complex; complexed with gtp, mg, zn |
PDB Entry: 2e2h (more details), 3.95 Å
SCOPe Domain Sequences for d2e2hi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2hi2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq
Timeline for d2e2hi2: