Lineage for d2e2hc2 (2e2h C:42-172)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561810Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 2561811Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 2561812Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 2561890Protein RPB3 [64462] (2 species)
  7. 2561891Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 2561914Domain d2e2hc2: 2e2h C:42-172 [131984]
    Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2he1, d2e2he2, d2e2hf1, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hk1, d2e2hl1
    automatically matched to d1i3qc2
    protein/DNA complex; protein/RNA complex; complexed with gtp, mg, zn

Details for d2e2hc2

PDB Entry: 2e2h (more details), 3.95 Å

PDB Description: RNA polymerase II elongation complex at 5 mM Mg2+ with GTP
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2e2hc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2hc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOPe Domain Coordinates for d2e2hc2:

Click to download the PDB-style file with coordinates for d2e2hc2.
(The format of our PDB-style files is described here.)

Timeline for d2e2hc2: