SCOPe 2.08: Domain d2cvlf_: 2cvl F:

Lineage for d2cvlf_ (2cvl F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (4 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein automated matches [190254] (5 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [187040] (2 PDB entries)

8. Domain d2cvlf_: 2cvl F: [130876]
   automated match to d1xrga_

Details for d2cvlf_

PDB Entry: 2cvl, 1.65 Å

PDB Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8

PDB Compounds: (F:) protein translation initiation inhibitor

SCOPe Domain Sequences for d2cvlf_:

Sequence; same for both SEQRES and ATOM records:

>d2cvlf_ d.79.1.1 (F:) automated matches {Thermus thermophilus [TaxId: 274]}
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae

Timeline for d2cvlf_:

• d2cvlf_ first appeared in SCOP 1.73, called d2cvlf1
  
• d2cvlf_ appears in SCOPe 2.07