Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein automated matches [190254] (5 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [187040] (2 PDB entries) |
Domain d2cvlc_: 2cvl C: [130873] automated match to d1xrga_ |
PDB Entry: 2cvl (more details), 1.65 Å
SCOPe Domain Sequences for d2cvlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvlc_ d.79.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]} meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv alae
Timeline for d2cvlc_: