Lineage for d2cvlc_ (2cvl C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958704Protein automated matches [190254] (5 species)
    not a true protein
  7. 2958745Species Thermus thermophilus [TaxId:274] [187040] (2 PDB entries)
  8. 2958748Domain d2cvlc_: 2cvl C: [130873]
    automated match to d1xrga_

Details for d2cvlc_

PDB Entry: 2cvl (more details), 1.65 Å

PDB Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8
PDB Compounds: (C:) protein translation initiation inhibitor

SCOPe Domain Sequences for d2cvlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvlc_ d.79.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae

SCOPe Domain Coordinates for d2cvlc_:

Click to download the PDB-style file with coordinates for d2cvlc_.
(The format of our PDB-style files is described here.)

Timeline for d2cvlc_: