Lineage for d1xrga_ (1xrg A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. Protein Purine regulatory protein YabJ [55302] (2 species)
  7. Species Clostridium thermocellum [TaxId:1515] [118024] (1 PDB entry)
    Uniprot Q4CI45
  8. Domain d1xrga_: 1xrg A: [115868]
    Other proteins in same PDB: d1xrgb2, d1xrgc2
    Structural genomics target
    complexed with unx

Details for d1xrga_

PDB Entry: 1xrg (more details), 2.2 Å

PDB Description: conserved hypothetical protein from clostridium thermocellum cth-2968
PDB Compounds: (A:) Putative translation initiation inhibitor, yjgF family

SCOPe Domain Sequences for d1xrga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrga_ d.79.1.1 (A:) Purine regulatory protein YabJ {Clostridium thermocellum [TaxId: 1515]}
yievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggieeqakqvlenlkn
vleaagsslnkvvkttvfikdmdsfakvnevyakyfsepyparscvevsklpkgvlieie
avaik

SCOPe Domain Coordinates for d1xrga_ are not available.

Timeline for d1xrga_:

Domains from other chains:
(mouse over for more information)
d1xrgb1, d1xrgb2, d1xrgc1, d1xrgc2